PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_023916-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 234aa    MW: 25927 Da    PI: 7.4156
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_023916-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.31.5e-5551147197
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                    vreqdrf+Pianv+rim+kvlPa+akis+daket+qecvse+isf+t+ea+d+cqre+rkti++dd+lwa+++lGf+dy+epl+vyl++yre+ege
  NNU_023916-RA  51 VREQDRFMPIANVIRIMRKVLPAHAKISDDAKETIQECVSEYISFITGEANDRCQREQRKTITADDVLWAMSKLGFDDYIEPLTVYLQRYREFEGE 146
                    69*********************************************************************************************9 PP

          NF-YB  97 k 97 
                    +
  NNU_023916-RA 147 R 147
                    7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-5047151IPR009072Histone-fold
SuperFamilySSF471131.55E-3854153IPR009072Histone-fold
PfamPF008083.1E-2557121IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-1685103No hitNo description
PROSITE patternPS00685088104IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-16104122No hitNo description
PRINTSPR006151.3E-16123141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MERAGFHGYQ RHPKSGSGMK MMVAANINHS SSNSQSTVVD DMSERDSGCT VREQDRFMPI  60
ANVIRIMRKV LPAHAKISDD AKETIQECVS EYISFITGEA NDRCQREQRK TITADDVLWA  120
MSKLGFDDYI EPLTVYLQRY REFEGERGSI RGGDPLVKRT ADLGGHALGI AAFTPAFHMG  180
VGVGHQHQHG HGVFGAAING GYRAMTNNNS SQPAPTINDH RISSDSYQPT YKHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-4050142193NF-YB
4awl_B1e-3950142294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3950142294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243940.11e-178PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
RefseqXP_010243941.11e-178PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
SwissprotQ84W665e-70NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLD7SZ494e-90D7SZ49_VITVI; Putative uncharacterized protein
STRINGVIT_00s0956g00020.t011e-89(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.18e-71nuclear factor Y, subunit B6